SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vgfa1 (3vgf A:3-90)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032237Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 protein domains)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2032380Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
    domain architecture similar to isoamylase
  7. 2032391Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (8 PDB entries)
  8. 2032393Domain d3vgfa1: 3vgf A:3-90 [250550]
    Other proteins in same PDB: d3vgfa2, d3vgfa3
    automated match to d1eh9a1
    complexed with flc, gol

Details for d3vgfa1

PDB Entry: 3vgf (more details), 2.3 Å

PDB Description: Crystal structure of glycosyltrehalose trehalohydrolase (D252S) complexed with maltotriosyltrehalose
PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgfa1 b.1.18.2 (A:3-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Sulfolobus solfataricus, km1 [TaxId: 2287]}
aykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldd
aseipdpasryqpegvhgpsqiiqeske

SCOPe Domain Coordinates for d3vgfa1:

Click to download the PDB-style file with coordinates for d3vgfa1.
(The format of our PDB-style files is described here.)

Timeline for d3vgfa1: