| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
| Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (8 PDB entries) |
| Domain d3vgfa1: 3vgf A:3-90 [250550] Other proteins in same PDB: d3vgfa2, d3vgfa3 automated match to d1eh9a1 complexed with flc, gol |
PDB Entry: 3vgf (more details), 2.3 Å
SCOPe Domain Sequences for d3vgfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgfa1 b.1.18.2 (A:3-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Sulfolobus solfataricus, km1 [TaxId: 2287]}
aykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldd
aseipdpasryqpegvhgpsqiiqeske
Timeline for d3vgfa1: