SCOPe 2.03: Domain d1cqfa_: 1cqf A:

Lineage for d1cqfa_ (1cqf A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)

8. Domain d1cqfa_: 1cqf A: [25055]
   complex with Gb3 trisaccharide

Details for d1cqfa_

PDB Entry: 1cqf, 2.2 Å

PDB Description: the complex of the mutated shiga toxin b subunit and gb3 trisaccharide

PDB Compounds: (A:) shiga toxin b-chain

SCOPe Domain Sequences for d1cqfa_:

Sequence; same for both SEQRES and ATOM records:

>d1cqfa_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

Timeline for d1cqfa_:

• d1cqfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqfa_ appears in SCOPe 2.02
  
• d1cqfa_ appears in SCOPe 2.04
  
• d1cqfa_ appears in the current release, SCOPe 2.08