| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Glycosyltrehalose trehalohydrolase [51034] (2 species) |
| Species Sulfolobus solfataricus, km1 [TaxId:2287] [51035] (8 PDB entries) |
| Domain d3vgea3: 3vge A:491-557 [250549] Other proteins in same PDB: d3vgea1, d3vgea2 automated match to d3vgba3 complexed with flc, gol |
PDB Entry: 3vge (more details), 2.7 Å
SCOPe Domain Sequences for d3vgea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgea3 b.71.1.1 (A:491-557) Glycosyltrehalose trehalohydrolase {Sulfolobus solfataricus, km1 [TaxId: 2287]}
cdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpqhieegkyefd
kgfalyk
Timeline for d3vgea3: