SCOPe 2.05: Domain d3vgda2: 3vgd A:91-490

Lineage for d3vgda2 (3vgd A:91-490)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
   contains an additional N-terminal domain

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (8 PDB entries)

8. Domain d3vgda2: 3vgd A:91-490 [250545]
   Other proteins in same PDB: d3vgda1, d3vgda3
   automated match to d3vgba2
   complexed with flc, gol

Details for d3vgda2

PDB Entry: 3vgd, 2.4 Å

PDB Description: ctystal structure of glycosyltrehalose trehalohydrolase (d252e)

PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgda2:

Sequence; same for both SEQRES and ATOM records:

>d3vgda2 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrleavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekcgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

Timeline for d3vgda2:

• d3vgda2 first appeared in SCOPe 2.04
  
• d3vgda2 appears in SCOPe 2.06
  
• d3vgda2 appears in the current release, SCOPe 2.08