![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
![]() | Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (8 PDB entries) |
![]() | Domain d3vgda1: 3vgd A:3-88 [250544] Other proteins in same PDB: d3vgda2, d3vgda3 automated match to d1eh9a1 complexed with flc, gol |
PDB Entry: 3vgd (more details), 2.4 Å
SCOPe Domain Sequences for d3vgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgda1 b.1.18.2 (A:3-88) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Sulfolobus solfataricus, km1 [TaxId: 2287]} aykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldd aseipdpasryqpegvhgpsqiiqes
Timeline for d3vgda1: