Lineage for d3vgda1 (3vgd A:3-88)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765334Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
    domain architecture similar to isoamylase
  7. 2765345Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (8 PDB entries)
  8. 2765350Domain d3vgda1: 3vgd A:3-88 [250544]
    Other proteins in same PDB: d3vgda2, d3vgda3
    automated match to d1eh9a1
    complexed with flc, gol

Details for d3vgda1

PDB Entry: 3vgd (more details), 2.4 Å

PDB Description: ctystal structure of glycosyltrehalose trehalohydrolase (d252e)
PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgda1 b.1.18.2 (A:3-88) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Sulfolobus solfataricus, km1 [TaxId: 2287]}
aykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldd
aseipdpasryqpegvhgpsqiiqes

SCOPe Domain Coordinates for d3vgda1:

Click to download the PDB-style file with coordinates for d3vgda1.
(The format of our PDB-style files is described here.)

Timeline for d3vgda1: