Lineage for d3vgab1 (3vga B:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767141Domain d3vgab1: 3vga B:1-107 [250542]
    Other proteins in same PDB: d3vgab2
    automated match to d1a5fl1
    complexed with zma

Details for d3vgab1

PDB Entry: 3vga (more details), 3.1 Å

PDB Description: Crystal structure of human adenosine A2A receptor with an allosteric inverse-agonist antibody at 3.1 A resolution
PDB Compounds: (B:) antibody fab fragment light chain

SCOPe Domain Sequences for d3vgab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgab1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspaslsasvgdtvtitcrasefiyssltwyqqkqggspqllvyaatnladavps
rfsgsgsgtqfslkinrlqpedfgtyycqhfygstwafgggtkleik

SCOPe Domain Coordinates for d3vgab1:

Click to download the PDB-style file with coordinates for d3vgab1.
(The format of our PDB-style files is described here.)

Timeline for d3vgab1: