Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species) phage-borne toxin; bacteriophages H30 and H19B |
Species Escherichia coli [TaxId:562] [50211] (13 PDB entries) |
Domain d1qoht_: 1qoh T: [25054] A mutant shiga-like toxin IIe |
PDB Entry: 1qoh (more details), 2.35 Å
SCOP Domain Sequences for d1qoht_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qoht_ b.40.2.1 (T:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]} adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs gfaevqfn
Timeline for d1qoht_: