Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (19 species) not a true protein |
Species Rhodococcus jostii [TaxId:101510] [256041] (8 PDB entries) |
Domain d3veeb_: 3vee B: [250529] automated match to d2gvka1 complexed with cl, fmt, hem |
PDB Entry: 3vee (more details), 2.4 Å
SCOPe Domain Sequences for d3veeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3veeb_ d.58.4.0 (B:) automated matches {Rhodococcus jostii [TaxId: 101510]} arlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscvv gvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqivs algsaatvvdevhgfryfdsrdllgfvdgtenptdddaadsaligdedpdfrggsyvivq kylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilrd amafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffvp srdvleslg
Timeline for d3veeb_: