SCOPe 2.04: Domain d3veeb_: 3vee B:

Lineage for d3veeb_ (3vee B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (19 species)
   not a true protein

7. Species Rhodococcus jostii [TaxId:101510] [256041] (8 PDB entries)

8. Domain d3veeb_: 3vee B: [250529]
   automated match to d2gvka1
   complexed with cl, fmt, hem

Details for d3veeb_

PDB Entry: 3vee, 2.4 Å

PDB Description: Rhodococcus jostii RHA1 DypB N246A variant in complex with heme

PDB Compounds: (B:) DypB

SCOPe Domain Sequences for d3veeb_:

Sequence; same for both SEQRES and ATOM records:

>d3veeb_ d.58.4.0 (B:) automated matches {Rhodococcus jostii [TaxId: 101510]}
arlapqavltppsaaslflvlvagdsdddratvcdvisgidgplkavgfrelagslscvv
gvgaqfwdrvsasskpahlhpfvplsgpvhsapstpgdllfhikaarkdlcfelgrqivs
algsaatvvdevhgfryfdsrdllgfvdgtenptdddaadsaligdedpdfrggsyvivq
kylhdmsawntlsteeqervigrtklenveldddaqpsnshvtlntivdddgvehdilrd
amafgslgeaeygtyfigyakdpavtelmlrrmflgeppgnydrvldfstaatgtlffvp
srdvleslg

Timeline for d3veeb_:

• d3veeb_ is new in SCOPe 2.04-stable
  
• d3veeb_ appears in SCOPe 2.05
  
• d3veeb_ appears in the current release, SCOPe 2.08