Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d3vdcd1: 3vdc D:9-219 [250513] Other proteins in same PDB: d3vdca2, d3vdca3, d3vdca4, d3vdca5, d3vdcb2, d3vdcb3, d3vdcb4, d3vdcb5, d3vdcc2, d3vdcc3, d3vdcc4, d3vdcc5, d3vdcd2, d3vdcd3, d3vdcd4, d3vdcd5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3vdc (more details), 2.55 Å
SCOPe Domain Sequences for d3vdcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdcd1 b.18.1.5 (D:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3vdcd1:
View in 3D Domains from same chain: (mouse over for more information) d3vdcd2, d3vdcd3, d3vdcd4, d3vdcd5 |