SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vdcd1 (3vdc D:9-219)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039263Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 protein domains)
  6. 2039264Protein beta-Galactosidase [49804] (2 species)
  7. 2039272Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 2039380Domain d3vdcd1: 3vdc D:9-219 [250513]
    Other proteins in same PDB: d3vdca2, d3vdca3, d3vdca4, d3vdca5, d3vdcb2, d3vdcb3, d3vdcb4, d3vdcb5, d3vdcc2, d3vdcc3, d3vdcc4, d3vdcc5, d3vdcd2, d3vdcd3, d3vdcd4, d3vdcd5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3vdcd1

PDB Entry: 3vdc (more details), 2.55 Å

PDB Description: E. coli (lacZ) beta-galactosidase (N460T) in complex with IPTG
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3vdcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdcd1 b.18.1.5 (D:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3vdcd1:

Click to download the PDB-style file with coordinates for d3vdcd1.
(The format of our PDB-style files is described here.)

Timeline for d3vdcd1: