Class b: All beta proteins [48724] (177 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (42 PDB entries) Uniprot P00722 |
Domain d3vdcb5: 3vdc B:731-1023 [250507] Other proteins in same PDB: d3vdca1, d3vdca2, d3vdca3, d3vdca4, d3vdcb1, d3vdcb2, d3vdcb3, d3vdcb4, d3vdcc1, d3vdcc2, d3vdcc3, d3vdcc4, d3vdcd1, d3vdcd2, d3vdcd3, d3vdcd4 automated match to d1jz8a4 complexed with dms, ipt, mg, na |
PDB Entry: 3vdc (more details), 2.55 Å
SCOPe Domain Sequences for d3vdcb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdcb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3vdcb5:
View in 3D Domains from same chain: (mouse over for more information) d3vdcb1, d3vdcb2, d3vdcb3, d3vdcb4 |