Lineage for d3vdcb5 (3vdc B:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2052584Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2052585Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2052593Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2052699Domain d3vdcb5: 3vdc B:731-1023 [250507]
    Other proteins in same PDB: d3vdca1, d3vdca2, d3vdca3, d3vdca4, d3vdcb1, d3vdcb2, d3vdcb3, d3vdcb4, d3vdcc1, d3vdcc2, d3vdcc3, d3vdcc4, d3vdcd1, d3vdcd2, d3vdcd3, d3vdcd4
    automated match to d1jz8a4
    complexed with dms, ipt, mg, na

Details for d3vdcb5

PDB Entry: 3vdc (more details), 2.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t) in complex with iptg
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3vdcb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdcb5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3vdcb5:

Click to download the PDB-style file with coordinates for d3vdcb5.
(The format of our PDB-style files is described here.)

Timeline for d3vdcb5: