Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (42 PDB entries) Uniprot P00722 |
Domain d3vdba3: 3vdb A:334-625 [250480] Other proteins in same PDB: d3vdba1, d3vdba2, d3vdba4, d3vdba5, d3vdbb1, d3vdbb2, d3vdbb4, d3vdbb5, d3vdbc1, d3vdbc2, d3vdbc4, d3vdbc5, d3vdbd1, d3vdbd2, d3vdbd4, d3vdbd5 automated match to d1jz7a5 complexed with 149, dms, mg, na |
PDB Entry: 3vdb (more details), 2.05 Å
SCOPe Domain Sequences for d3vdba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdba3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgtesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3vdba3:
View in 3D Domains from same chain: (mouse over for more information) d3vdba1, d3vdba2, d3vdba4, d3vdba5 |