Lineage for d3vdba3 (3vdb A:334-625)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1818879Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1818887Species Escherichia coli [TaxId:562] [51511] (42 PDB entries)
    Uniprot P00722
  8. 1818932Domain d3vdba3: 3vdb A:334-625 [250480]
    Other proteins in same PDB: d3vdba1, d3vdba2, d3vdba4, d3vdba5, d3vdbb1, d3vdbb2, d3vdbb4, d3vdbb5, d3vdbc1, d3vdbc2, d3vdbc4, d3vdbc5, d3vdbd1, d3vdbd2, d3vdbd4, d3vdbd5
    automated match to d1jz7a5
    complexed with 149, dms, mg, na

Details for d3vdba3

PDB Entry: 3vdb (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460t) in complex with galactonolactone
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3vdba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdba3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgtesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3vdba3:

Click to download the PDB-style file with coordinates for d3vdba3.
(The format of our PDB-style files is described here.)

Timeline for d3vdba3: