![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (41 PDB entries) Uniprot P00722 |
![]() | Domain d3vdac2: 3vda C:220-333 [250469] Other proteins in same PDB: d3vdaa1, d3vdaa3, d3vdaa5, d3vdab1, d3vdab3, d3vdab5, d3vdac1, d3vdac3, d3vdac5, d3vdad1, d3vdad3, d3vdad5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3vda (more details), 2.5 Å
SCOPe Domain Sequences for d3vdac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdac2 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3vdac2:
![]() Domains from same chain: (mouse over for more information) d3vdac1, d3vdac3, d3vdac4, d3vdac5 |