Lineage for d3vdab4 (3vda B:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1522035Domain d3vdab4: 3vda B:626-730 [250466]
    Other proteins in same PDB: d3vdaa1, d3vdaa3, d3vdaa5, d3vdab1, d3vdab3, d3vdab5, d3vdac1, d3vdac3, d3vdac5, d3vdad1, d3vdad3, d3vdad5
    automated match to d1jz8a2
    complexed with dms, mg, na

Details for d3vdab4

PDB Entry: 3vda (more details), 2.5 Å

PDB Description: E. coli (lacZ) beta-galactosidase (N460T)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3vdab4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdab4 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3vdab4:

Click to download the PDB-style file with coordinates for d3vdab4.
(The format of our PDB-style files is described here.)

Timeline for d3vdab4: