Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (42 PDB entries) Uniprot P00722 |
Domain d3vdaa4: 3vda A:626-730 [250461] Other proteins in same PDB: d3vdaa1, d3vdaa3, d3vdaa5, d3vdab1, d3vdab3, d3vdab5, d3vdac1, d3vdac3, d3vdac5, d3vdad1, d3vdad3, d3vdad5 automated match to d1jz8a2 complexed with dms, mg, na |
PDB Entry: 3vda (more details), 2.5 Å
SCOPe Domain Sequences for d3vdaa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vdaa4 b.1.4.1 (A:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3vdaa4:
View in 3D Domains from same chain: (mouse over for more information) d3vdaa1, d3vdaa2, d3vdaa3, d3vdaa5 |