Lineage for d3vd9d4 (3vd9 D:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1521959Domain d3vd9d4: 3vd9 D:626-730 [250456]
    Other proteins in same PDB: d3vd9a1, d3vd9a3, d3vd9a5, d3vd9b1, d3vd9b3, d3vd9b5, d3vd9c1, d3vd9c3, d3vd9c5, d3vd9d1, d3vd9d3, d3vd9d5
    automated match to d1jz8a2
    complexed with dms, ipt, mg, na

Details for d3vd9d4

PDB Entry: 3vd9 (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with iptg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3vd9d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd9d4 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3vd9d4:

Click to download the PDB-style file with coordinates for d3vd9d4.
(The format of our PDB-style files is described here.)

Timeline for d3vd9d4: