SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vd7d5 (3vd7 D:731-1023)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2044683Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2044684Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2044692Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2044816Domain d3vd7d5: 3vd7 D:731-1023 [250437]
    Other proteins in same PDB: d3vd7a1, d3vd7a2, d3vd7a3, d3vd7a4, d3vd7b1, d3vd7b2, d3vd7b3, d3vd7b4, d3vd7c1, d3vd7c2, d3vd7c3, d3vd7c4, d3vd7d1, d3vd7d2, d3vd7d3, d3vd7d4
    automated match to d1jz8a4
    complexed with dms, gtz, mg, na

Details for d3vd7d5

PDB Entry: 3vd7 (more details), 2.87 Å

PDB Description: E. coli (lacZ) beta-galactosidase (N460S) in complex with galactotetrazole
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3vd7d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd7d5 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3vd7d5:

Click to download the PDB-style file with coordinates for d3vd7d5.
(The format of our PDB-style files is described here.)

Timeline for d3vd7d5: