Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species) |
Species Escherichia coli [TaxId:562] [49306] (41 PDB entries) Uniprot P00722 |
Domain d3vd7c4: 3vd7 C:626-730 [250431] Other proteins in same PDB: d3vd7a1, d3vd7a3, d3vd7a5, d3vd7b1, d3vd7b3, d3vd7b5, d3vd7c1, d3vd7c3, d3vd7c5, d3vd7d1, d3vd7d3, d3vd7d5 automated match to d1jz8a2 complexed with dms, gtz, mg, na |
PDB Entry: 3vd7 (more details), 2.87 Å
SCOPe Domain Sequences for d3vd7c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd7c4 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3vd7c4:
View in 3D Domains from same chain: (mouse over for more information) d3vd7c1, d3vd7c2, d3vd7c3, d3vd7c5 |