Lineage for d3vd7b3 (3vd7 B:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830855Domain d3vd7b3: 3vd7 B:334-625 [250425]
    Other proteins in same PDB: d3vd7a1, d3vd7a2, d3vd7a4, d3vd7a5, d3vd7b1, d3vd7b2, d3vd7b4, d3vd7b5, d3vd7c1, d3vd7c2, d3vd7c4, d3vd7c5, d3vd7d1, d3vd7d2, d3vd7d4, d3vd7d5
    automated match to d1jz7a5
    complexed with dms, gtz, mg, na

Details for d3vd7b3

PDB Entry: 3vd7 (more details), 2.87 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with galactotetrazole
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3vd7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd7b3 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgsesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3vd7b3:

Click to download the PDB-style file with coordinates for d3vd7b3.
(The format of our PDB-style files is described here.)

Timeline for d3vd7b3: