Lineage for d3vd7b1 (3vd7 B:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774444Domain d3vd7b1: 3vd7 B:13-219 [250423]
    Other proteins in same PDB: d3vd7a2, d3vd7a3, d3vd7a4, d3vd7a5, d3vd7b2, d3vd7b3, d3vd7b4, d3vd7b5, d3vd7c2, d3vd7c3, d3vd7c4, d3vd7c5, d3vd7d2, d3vd7d3, d3vd7d4, d3vd7d5
    automated match to d1f49a3
    complexed with dms, gtz, mg, na

Details for d3vd7b1

PDB Entry: 3vd7 (more details), 2.87 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with galactotetrazole
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3vd7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd7b1 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3vd7b1:

Click to download the PDB-style file with coordinates for d3vd7b1.
(The format of our PDB-style files is described here.)

Timeline for d3vd7b1: