![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3vd5c2: 3vd5 C:220-333 [250409] Other proteins in same PDB: d3vd5a1, d3vd5a3, d3vd5a5, d3vd5b1, d3vd5b3, d3vd5b5, d3vd5c1, d3vd5c3, d3vd5c5, d3vd5d1, d3vd5d3, d3vd5d5 automated match to d1jz8a1 complexed with dms, mg, na |
PDB Entry: 3vd5 (more details), 2.7 Å
SCOPe Domain Sequences for d3vd5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd5c2 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d3vd5c2:
![]() Domains from same chain: (mouse over for more information) d3vd5c1, d3vd5c3, d3vd5c4, d3vd5c5 |