| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d3vd5c1: 3vd5 C:13-219 [250408] Other proteins in same PDB: d3vd5a2, d3vd5a3, d3vd5a4, d3vd5a5, d3vd5b2, d3vd5b3, d3vd5b4, d3vd5b5, d3vd5c2, d3vd5c3, d3vd5c4, d3vd5c5, d3vd5d2, d3vd5d3, d3vd5d4, d3vd5d5 automated match to d1f49a3 complexed with dms, mg, na |
PDB Entry: 3vd5 (more details), 2.7 Å
SCOPe Domain Sequences for d3vd5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd5c1 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3vd5c1:
View in 3DDomains from same chain: (mouse over for more information) d3vd5c2, d3vd5c3, d3vd5c4, d3vd5c5 |