Lineage for d1qohf_ (1qoh F:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374244Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 374245Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 374322Domain d1qohf_: 1qoh F: [25040]

Details for d1qohf_

PDB Entry: 1qoh (more details), 2.35 Å

PDB Description: a mutant shiga-like toxin iie

SCOP Domain Sequences for d1qohf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qohf_ b.40.2.1 (F:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn

SCOP Domain Coordinates for d1qohf_:

Click to download the PDB-style file with coordinates for d1qohf_.
(The format of our PDB-style files is described here.)

Timeline for d1qohf_: