Class b: All beta proteins [48724] (177 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d3vd4b1: 3vd4 B:9-219 [250383] Other proteins in same PDB: d3vd4a2, d3vd4a3, d3vd4a4, d3vd4a5, d3vd4b2, d3vd4b3, d3vd4b4, d3vd4b5, d3vd4c2, d3vd4c3, d3vd4c4, d3vd4c5, d3vd4d2, d3vd4d3, d3vd4d4, d3vd4d5 automated match to d1f49a3 complexed with dms, ipt, mg, na |
PDB Entry: 3vd4 (more details), 2 Å
SCOPe Domain Sequences for d3vd4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd4b1 b.18.1.5 (B:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3vd4b1:
View in 3D Domains from same chain: (mouse over for more information) d3vd4b2, d3vd4b3, d3vd4b4, d3vd4b5 |