Lineage for d3vd4b1 (3vd4 B:9-219)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046412Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2046413Protein beta-Galactosidase [49804] (2 species)
  7. 2046421Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 2046471Domain d3vd4b1: 3vd4 B:9-219 [250383]
    Other proteins in same PDB: d3vd4a2, d3vd4a3, d3vd4a4, d3vd4a5, d3vd4b2, d3vd4b3, d3vd4b4, d3vd4b5, d3vd4c2, d3vd4c3, d3vd4c4, d3vd4c5, d3vd4d2, d3vd4d3, d3vd4d4, d3vd4d5
    automated match to d1f49a3
    complexed with dms, ipt, mg, na

Details for d3vd4b1

PDB Entry: 3vd4 (more details), 2 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460d) in complex with iptg
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3vd4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd4b1 b.18.1.5 (B:9-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3vd4b1:

Click to download the PDB-style file with coordinates for d3vd4b1.
(The format of our PDB-style files is described here.)

Timeline for d3vd4b1: