Lineage for d3vd3d4 (3vd3 D:626-730)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762432Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2762446Species Escherichia coli [TaxId:562] [49306] (46 PDB entries)
    Uniprot P00722
  8. 2762846Domain d3vd3d4: 3vd3 D:626-730 [250376]
    Other proteins in same PDB: d3vd3a1, d3vd3a3, d3vd3a5, d3vd3b1, d3vd3b3, d3vd3b5, d3vd3c1, d3vd3c3, d3vd3c5, d3vd3d1, d3vd3d3, d3vd3d5
    automated match to d1jz8a2
    complexed with dms, mg, na

Details for d3vd3d4

PDB Entry: 3vd3 (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460d)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3vd3d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd3d4 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d3vd3d4:

Click to download the PDB-style file with coordinates for d3vd3d4.
(The format of our PDB-style files is described here.)

Timeline for d3vd3d4: