| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
| Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
| Domain d3vd3c4: 3vd3 C:626-730 [250371] Other proteins in same PDB: d3vd3a1, d3vd3a3, d3vd3a5, d3vd3b1, d3vd3b3, d3vd3b5, d3vd3c1, d3vd3c3, d3vd3c5, d3vd3d1, d3vd3d3, d3vd3d5 automated match to d1jz8a2 complexed with dms, mg, na |
PDB Entry: 3vd3 (more details), 2.8 Å
SCOPe Domain Sequences for d3vd3c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd3c4 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3vd3c4:
View in 3DDomains from same chain: (mouse over for more information) d3vd3c1, d3vd3c2, d3vd3c3, d3vd3c5 |