SCOPe 2.07: Domain d3vbsa_: 3vbs A:

Lineage for d3vbsa_ (3vbs A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [226325] (11 PDB entries)

8. Domain d3vbsa_: 3vbs A: [250356]
   automated match to d3vbha_
   complexed with sph

Details for d3vbsa_

PDB Entry: 3vbs, 3 Å

PDB Description: Crystal structure of human Enterovirus 71

PDB Compounds: (A:) Genome Polyprotein, capsid protein VP1

SCOPe Domain Sequences for d3vbsa_:

Sequence; same for both SEQRES and ATOM records:

>d3vbsa_ b.121.4.0 (A:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gdrvadviessigdsvsralthalpaptgqntqvsshrldtgkvpalqaaeigassnasd
esmietrcvlnshstaettldsffsraglvgeidlplkgttnpngyanwdiditgyaqmr
rkvelftymrfdaeftfvactptgevvpqllqymfvppgapkpdsreslawqtatnpsvf
vklsdppaqvsvpfmspasayqwfydgyptfgehkqekdleygampnnmmgtfsvrtvgt
skskyplvvriymrmkhvrawiprpmrnqnylfkanpnyagnsikptgasrtaittl

Timeline for d3vbsa_:

• d3vbsa_ first appeared in SCOPe 2.04
  
• d3vbsa_ appears in SCOPe 2.06
  
• d3vbsa_ appears in the current release, SCOPe 2.08