Lineage for d3v9ja1 (3v9j A:22-563)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141334Species Mouse (Mus musculus) [TaxId:10090] [256133] (9 PDB entries)
  8. 2141337Domain d3v9ja1: 3v9j A:22-563 [250350]
    Other proteins in same PDB: d3v9ja2, d3v9jb2
    automated match to d4oe5a_
    complexed with gol, so4

Details for d3v9ja1

PDB Entry: 3v9j (more details), 1.3 Å

PDB Description: Crystal structure of mouse 1-pyrroline-5-carboxylate dehydrogenase complexed with sulfate ion
PDB Compounds: (A:) Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d3v9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v9ja1 c.82.1.0 (A:22-563) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lrwkhtsslkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyq
lspfnhahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprra
evlaktmvgqgktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrgle
gfvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqf
vpadgptfgdtvtssehlcginftgsvptfkhlwrqvaqnldrfrtfprlagecggknfh
fvhssadvdsvvsgtlrsafeyggqkcsacsrlyvpkslwpqikgrlleehsrikvgdpa
edfgtffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqe
pimkeeifgpvltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaa
gnfyindkstgsvvgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysy
mq

SCOPe Domain Coordinates for d3v9ja1:

Click to download the PDB-style file with coordinates for d3v9ja1.
(The format of our PDB-style files is described here.)

Timeline for d3v9ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v9ja2