Lineage for d3v9hc_ (3v9h C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (55 species)
    not a true protein
  7. 2482355Species Human (Homo sapiens) [TaxId:9606] [225691] (17 PDB entries)
  8. 2482384Domain d3v9hc_: 3v9h C: [250344]
    automated match to d4oe5a_
    complexed with so4; mutant

Details for d3v9hc_

PDB Entry: 3v9h (more details), 2.4 Å

PDB Description: crystal structure of human 1-pyrroline-5-carboxylate dehydrogenase mutant s352a
PDB Compounds: (C:) Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d3v9hc_:

Sequence, based on SEQRES records: (download)

>d3v9hc_ c.82.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
vhrsadvesvvsgtlrsafeyggqkcsacarlyvphslwpqikgrlleehsrikvgdpae
dfgtffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqep
imkeeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaag
nfyindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaym

Sequence, based on observed residues (ATOM records): (download)

>d3v9hc_ c.82.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqv
spfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprrae
ilaktmvgqgktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrgleg
fvaaispfnftaiggnlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfv
padgplfgdtvtssehlcginftgsvptfkhlwkqvaqnldrfhtfprlagecggknfhf
vhrsadvesvvsgtlrsafeyggqkcsacarlyvphslwpqikgrlleehsrikvgdpae
dfgtffsavidaksfarikkwleharssptilaggkcddsvgyfvepciveskdpqepim
keeifgpvlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaagnf
yindkstgsivgqqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaym

SCOPe Domain Coordinates for d3v9hc_:

Click to download the PDB-style file with coordinates for d3v9hc_.
(The format of our PDB-style files is described here.)

Timeline for d3v9hc_: