| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Trametes hirsuta [TaxId:5327] [255835] (4 PDB entries) |
| Domain d3v9ca1: 3v9c A:1-130 [250335] automated match to d1kyaa1 complexed with cu, nag, oxy |
PDB Entry: 3v9c (more details), 2 Å
SCOPe Domain Sequences for d3v9ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v9ca1 b.6.1.0 (A:1-130) automated matches {Trametes hirsuta [TaxId: 5327]}
avgpvadltitdaavspdgfsrqavvvngvtpgplvagnigdrfqlnvidnltnhtmlks
tsihwhgffqhgtnwadgpafinqcpispghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn
Timeline for d3v9ca1: