Lineage for d3v8oa1 (3v8o A:568-664)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771182Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)
  8. 1771197Domain d3v8oa1: 3v8o A:568-664 [250331]
    automated match to d2dj4a1
    complexed with k

Details for d3v8oa1

PDB Entry: 3v8o (more details), 2.8 Å

PDB Description: Human Filamin C Ig - like Domains 4 and 5
PDB Compounds: (A:) Filamin-C

SCOPe Domain Sequences for d3v8oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v8oa1 b.1.18.0 (A:568-664) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qagvqkvrawgpgletgqvgksadfvveaigtevgtlgfsiegpsqakiecddkgdgscd
vrywptepgeyavhvicddedirdspfiahilpappd

SCOPe Domain Coordinates for d3v8oa1:

Click to download the PDB-style file with coordinates for d3v8oa1.
(The format of our PDB-style files is described here.)

Timeline for d3v8oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v8oa2