Lineage for d3v8db_ (3v8d B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1744326Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1744327Protein automated matches [190847] (45 species)
    not a true protein
  7. 1744362Species Human (Homo sapiens) [TaxId:9606] [196470] (29 PDB entries)
  8. 1744374Domain d3v8db_: 3v8d B: [250330]
    automated match to d3sn5a_
    complexed with 0gv, hem, so4, unx

Details for d3v8db_

PDB Entry: 3v8d (more details), 1.9 Å

PDB Description: crystal structure of human cyp7a1 in complex with 7-ketocholesterol
PDB Compounds: (B:) Cholesterol 7-alpha-monooxygenase

SCOPe Domain Sequences for d3v8db_:

Sequence, based on SEQRES records: (download)

>d3v8db_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpl
syhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnslte
smmenlqrimrppvssnsktaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahil
nnldnfkqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmfl
ndtlstfddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenag
qkvslegnpiclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirk
ddiialypqlmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgati
cpgrlfaiheikqflilmlsyfeleliegqakcppldqsraglgilpplndiefkykfk

Sequence, based on observed residues (ATOM records): (download)

>d3v8db_ a.104.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrrqtgepplenglipylgcalqfganpleflranqrkhghvftcklmgkyvhfitnpl
syhkvlchgkyfdwkkfhfalsakafghrsidpmdgnttenindtfiktlqghalnslte
smmenlqrimrppvaawvtegmysfcyrvmfeagyltifgrdltrrdtqkahilnnldnf
kqfdkvfpalvaglpihmfrtahnareklaeslrhenlqkresiselislrmflndtlst
fddlekakthlvvlwasqantipatfwslfqmirnpeamkaateevkrtlenagqkvslp
iclsqaelndlpvldsiikeslrlssaslnirtakedftlhledgsynirkddiialypq
lmhldpeiypdpltfkydryldengktkttfycnglklkyyympfgsgaticpgrlfaih
eikqflilmlsyfeleliakcppldqsraglgilpplndiefkykfk

SCOPe Domain Coordinates for d3v8db_:

Click to download the PDB-style file with coordinates for d3v8db_.
(The format of our PDB-style files is described here.)

Timeline for d3v8db_: