SCOPe 2.08: Domain d3v7ka2: 3v7k A:92-148

Lineage for d3v7ka2 (3v7k A:92-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)

8. Domain d3v7ka2: 3v7k A:92-148 [250324]
   Other proteins in same PDB: d3v7ka1, d3v7ka3
   automated match to d4klia2
   protein/DNA complex; complexed with na

Details for d3v7ka2

PDB Entry: 3v7k, 2.27 Å

PDB Description: co-crystal structure of k72e variant of rat polymerase beta: enzyme- dna binary complex

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3v7ka2:

Sequence; same for both SEQRES and ATOM records:

>d3v7ka2 a.60.12.1 (A:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d3v7ka2:

• d3v7ka2 first appeared in SCOPe 2.04
  
• d3v7ka2 appears in SCOPe 2.07