SCOPe 2.08: Domain d3v7ka1: 3v7k A:5-91

Lineage for d3v7ka1 (3v7k A:5-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries)

8. Domain d3v7ka1: 3v7k A:5-91 [250323]
   Other proteins in same PDB: d3v7ka2, d3v7ka3
   automated match to d1tv9a1
   protein/DNA complex; complexed with na

Details for d3v7ka1

PDB Entry: 3v7k, 2.27 Å

PDB Description: co-crystal structure of k72e variant of rat polymerase beta: enzyme- dna binary complex

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3v7ka1:

Sequence; same for both SEQRES and ATOM records:

>d3v7ka1 a.60.6.1 (A:5-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpg
vgtkiaeeideflatgklrklekirqd

Timeline for d3v7ka1:

• d3v7ka1 first appeared in SCOPe 2.04
  
• d3v7ka1 appears in SCOPe 2.07