Lineage for d3v7ja3 (3v7j A:149-335)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 protein domains)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563574Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 2563721Species Norway rat (Rattus norvegicus) [TaxId:10116] [81576] (23 PDB entries)
  8. 2563722Domain d3v7ja3: 3v7j A:149-335 [250322]
    Other proteins in same PDB: d3v7ja1, d3v7ja2
    automated match to d4klia3
    protein/DNA complex; complexed with cl, na

Details for d3v7ja3

PDB Entry: 3v7j (more details), 2.25 Å

PDB Description: Co-crystal structure of Wild Type Rat polymerase beta: Enzyme-DNA binary complex
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3v7ja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v7ja3 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrse

SCOPe Domain Coordinates for d3v7ja3:

Click to download the PDB-style file with coordinates for d3v7ja3.
(The format of our PDB-style files is described here.)

Timeline for d3v7ja3: