Lineage for d1d1kc_ (1d1k C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058761Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 2058768Species Escherichia coli [TaxId:562] [50211] (15 PDB entries)
  8. 2058801Domain d1d1kc_: 1d1k C: [25032]

Details for d1d1kc_

PDB Entry: 1d1k (more details), 2 Å

PDB Description: mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
PDB Compounds: (C:) shiga-like toxin I subunit b

SCOPe Domain Sequences for d1d1kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1kc_ b.40.2.1 (C:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1d1kc_:

Click to download the PDB-style file with coordinates for d1d1kc_.
(The format of our PDB-style files is described here.)

Timeline for d1d1kc_: