Lineage for d3v4vn2 (3v4v N:114-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (569 PDB entries)
  8. 2028972Domain d3v4vn2: 3v4v N:114-217 [250312]
    Other proteins in same PDB: d3v4vl1, d3v4vn1
    automated match to d2jell2
    complexed with 0du, ca, mg, nag, trs

Details for d3v4vn2

PDB Entry: 3v4v (more details), 3.1 Å

PDB Description: crystal structure of a4b7 headpiece complexed with Fab ACT-1 and RO0505376
PDB Compounds: (N:) MONOCLONAL ANTIBODY Act-1 LIGHT CHAIN

SCOPe Domain Sequences for d3v4vn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4vn2 b.1.1.0 (N:114-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwnidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d3v4vn2:

Click to download the PDB-style file with coordinates for d3v4vn2.
(The format of our PDB-style files is described here.)

Timeline for d3v4vn2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v4vn1