Lineage for d3v4qa_ (3v4q A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040442Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) (S)
  5. 3040443Family h.1.20.1: Intermediate filament protein, coiled coil region [64594] (3 proteins)
    C-terminal part of Pfam PF00038
  6. 3040458Protein automated matches [254728] (1 species)
    not a true protein
  7. 3040459Species Human (Homo sapiens) [TaxId:9606] [256132] (2 PDB entries)
  8. 3040460Domain d3v4qa_: 3v4q A: [250308]
    automated match to d1x8ya_
    mutant

Details for d3v4qa_

PDB Entry: 3v4q (more details), 3.06 Å

PDB Description: structure of r335w mutant of human lamin
PDB Compounds: (A:) Prelamin-A/C

SCOPe Domain Sequences for d3v4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4qa_ h.1.20.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laakeaklrdledslarerdtswrllaekeremaemrarmqqqldeyqelldiklaldme
ihayrkllegeeer

SCOPe Domain Coordinates for d3v4qa_:

Click to download the PDB-style file with coordinates for d3v4qa_.
(The format of our PDB-style files is described here.)

Timeline for d3v4qa_: