![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) ![]() |
![]() | Family h.1.20.1: Intermediate filament protein, coiled coil region [64594] (3 proteins) C-terminal part of Pfam PF00038 |
![]() | Protein automated matches [254728] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256132] (2 PDB entries) |
![]() | Domain d3v4qa_: 3v4q A: [250308] automated match to d1x8ya_ mutant |
PDB Entry: 3v4q (more details), 3.06 Å
SCOPe Domain Sequences for d3v4qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4qa_ h.1.20.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} laakeaklrdledslarerdtswrllaekeremaemrarmqqqldeyqelldiklaldme ihayrkllegeeer
Timeline for d3v4qa_: