| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3v4pn2: 3v4p N:114-217 [250307] Other proteins in same PDB: d3v4ph1, d3v4ph2, d3v4pl1, d3v4pm1, d3v4pm2, d3v4pn1 automated match to d2jell2 complexed with 15p, ca, mg, nag, trs |
PDB Entry: 3v4p (more details), 3.15 Å
SCOPe Domain Sequences for d3v4pn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4pn2 b.1.1.0 (N:114-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwnidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d3v4pn2: