Lineage for d3v28x_ (3v28 X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006182Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 3006183Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 3006200Family d.204.1.0: automated matches [227270] (1 protein)
    not a true family
  6. 3006201Protein automated matches [227070] (6 species)
    not a true protein
  7. 3006207Species Escherichia coli K-12 [TaxId:83333] [256131] (2 PDB entries)
  8. 3006209Domain d3v28x_: 3v28 X: [250301]
    complexed with mg, zn
    complexed with mg, zn

Details for d3v28x_

PDB Entry: 3v28 (more details), 3.1 Å

PDB Description: Crystal structure of HPF bound to the 70S ribosome. This PDB entry contains coordinates for the 30S subunit with bound HPF of the 2nd ribosome in the ASU
PDB Compounds: (X:) Probable sigma(54) modulation protein

SCOPe Domain Sequences for d3v28x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v28x_ d.204.1.0 (X:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge
ihasaegqdmyaaidglidklarqltkhkdklkqh

SCOPe Domain Coordinates for d3v28x_:

Click to download the PDB-style file with coordinates for d3v28x_.
(The format of our PDB-style files is described here.)

Timeline for d3v28x_: