Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) automatically mapped to Pfam PF02482 |
Family d.204.1.0: automated matches [227270] (1 protein) not a true family |
Protein automated matches [227070] (6 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [256131] (2 PDB entries) |
Domain d3v28x_: 3v28 X: [250301] complexed with mg, zn complexed with mg, zn |
PDB Entry: 3v28 (more details), 3.1 Å
SCOPe Domain Sequences for d3v28x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v28x_ d.204.1.0 (X:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mqlnitgnnveitealrefvtakfakleqyfdrinqvyvvlkvekvthtsdatlhvngge ihasaegqdmyaaidglidklarqltkhkdklkqh
Timeline for d3v28x_: