Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Xenotropic mulv-related virus vp35 [TaxId:356663] [226326] (3 PDB entries) |
Domain d3v1ra_: 3v1r A: [250299] automated match to d3v1oa_ complexed with jth, mn, mrd, so4 |
PDB Entry: 3v1r (more details), 2.8 Å
SCOPe Domain Sequences for d3v1ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v1ra_ c.55.3.0 (A:) automated matches {Xenotropic mulv-related virus vp35 [TaxId: 356663]} hgtrpdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaqrae lialtqalkmaegkklnvytdsryafatahvhgeiyrrrglltsegreiknkneilallk alflpkrlsiihcpghqkgnsaeargnrmadqaareaamkavlet
Timeline for d3v1ra_: