Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (5 PDB entries) |
Domain d3v09a3: 3v09 A:389-583 [250298] automated match to d4emxa3 complexed with cl, edo, mes, pg4, unx |
PDB Entry: 3v09 (more details), 2.27 Å
SCOPe Domain Sequences for d3v09a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v09a3 a.126.1.0 (A:389-583) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} kqncelyeqlgdynfqnallvrytkkvpqvstptlveisrslgkvgskcckhpeaerlpc vedylsvvlnrlcvlhektpvsekvtkccseslvdrrpcfsalgpdetyvpkefnaetft fhadictlpeterkikkqtalvelvkhkphatndqlktvvgeftalldkccsaedkeacf avegpklvesskatl
Timeline for d3v09a3: