SCOPe 2.07: Domain d3v09a2: 3v09 A:197-388

Lineage for d3v09a2 (3v09 A:197-388)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (5 PDB entries)

8. Domain d3v09a2: 3v09 A:197-388 [250297]
   automated match to d4l8ua2
   complexed with cl, edo, mes, pg4, unk

Details for d3v09a2

PDB Entry: 3v09, 2.27 Å

PDB Description: crystal structure of rabbit serum albumin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3v09a2:

Sequence; same for both SEQRES and ATOM records:

>d3v09a2 a.126.1.0 (A:197-388) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rlrcasiqkfgdraykawalvrlsqrfpkadftdiskivtdltkvhkecchgdllecadd
radlakymcehqetisshlkeccdkpilekahciyglhndetpaglpavaeefvedkdvc
knyeeakdlflgkflyeysrrhpdysvvlllrlgkayeatlkkccatddphacyakvlde
fqplvdepknlv

Timeline for d3v09a2:

• d3v09a2 first appeared in SCOPe 2.04
  
• d3v09a2 appears in SCOPe 2.06
  
• d3v09a2 appears in the current release, SCOPe 2.08