![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (5 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (3 PDB entries) |
![]() | Domain d3v09a2: 3v09 A:197-388 [250297] automated match to d4l8ua2 complexed with cl, edo, mes, pg4, unk |
PDB Entry: 3v09 (more details), 2.27 Å
SCOPe Domain Sequences for d3v09a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v09a2 a.126.1.0 (A:197-388) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rlrcasiqkfgdraykawalvrlsqrfpkadftdiskivtdltkvhkecchgdllecadd radlakymcehqetisshlkeccdkpilekahciyglhndetpaglpavaeefvedkdvc knyeeakdlflgkflyeysrrhpdysvvlllrlgkayeatlkkccatddphacyakvlde fqplvdepknlv
Timeline for d3v09a2: