Lineage for d3v09a1 (3v09 A:1-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013840Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2013841Protein automated matches [254493] (6 species)
    not a true protein
  7. 2013997Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [256130] (3 PDB entries)
  8. 2013998Domain d3v09a1: 3v09 A:1-196 [250296]
    automated match to d3jrya1
    complexed with cl, edo, mes, pg4, unk

Details for d3v09a1

PDB Entry: 3v09 (more details), 2.27 Å

PDB Description: crystal structure of rabbit serum albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3v09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v09a1 a.126.1.0 (A:1-196) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eahkseiahrfndvgeehfiglvlitfsqylqkcpyeehaklvkevtdlakacvadesaa
ncdkslhdifgdkicalpslrdtygdvadccekkepernecflhhkddkpdlppfarpea
dvlckafhddekaffghylyevarrhpyfyapellyyaqkykailtecceaadkgacltp
kldalegkslisaaqe

SCOPe Domain Coordinates for d3v09a1:

Click to download the PDB-style file with coordinates for d3v09a1.
(The format of our PDB-style files is described here.)

Timeline for d3v09a1: