Lineage for d3v08a3 (3v08 A:388-583)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336647Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2336648Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2337021Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2337022Protein automated matches [254493] (6 species)
    not a true protein
  7. 2337067Species Horse (Equus caballus) [TaxId:9796] [256129] (18 PDB entries)
  8. 2337082Domain d3v08a3: 3v08 A:388-583 [250295]
    automated match to d4emxa3
    complexed with br, edo, pg4, so4, unx

Details for d3v08a3

PDB Entry: 3v08 (more details), 2.45 Å

PDB Description: Crystal structure of Equine Serum Albumin
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3v08a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v08a3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgredkeacf
aeegpklvassqlala

SCOPe Domain Coordinates for d3v08a3:

Click to download the PDB-style file with coordinates for d3v08a3.
(The format of our PDB-style files is described here.)

Timeline for d3v08a3: