SCOPe 2.08: Domain d3v03b2: 3v03 B:196-387

Lineage for d3v03b2 (3v03 B:196-387)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries)

8. Domain d3v03b2: 3v03 B:196-387 [250291]
   automated match to d4l8ua2
   complexed with act, ca

Details for d3v03b2

PDB Entry: 3v03, 2.7 Å

PDB Description: crystal structure of bovine serum albumin

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d3v03b2:

Sequence; same for both SEQRES and ATOM records:

>d3v03b2 a.126.1.0 (B:196-387) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rlrcasiqkfgeralkawsvarlsqkfpkaefvevtklvtdltkvhkecchgdllecadd
radlakyicdnqdtissklkeccdkpllekshciaevekdaipenlppltadfaedkdvc
knyqeakdaflgsflyeysrrhpeyavsvllrlakeyeatleeccakddphacystvfdk
lkhlvdepqnli

Timeline for d3v03b2:

• d3v03b2 first appeared in SCOPe 2.04
  
• d3v03b2 appears in SCOPe 2.07