Lineage for d2bose_ (2bos E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13820Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 13821Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 13841Domain d2bose_: 2bos E: [25029]

Details for d2bose_

PDB Entry: 2bos (more details), 2 Å

PDB Description: a mutant shiga-like toxin iie bound to its receptor

SCOP Domain Sequences for d2bose_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bose_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn

SCOP Domain Coordinates for d2bose_:

Click to download the PDB-style file with coordinates for d2bose_.
(The format of our PDB-style files is described here.)

Timeline for d2bose_: