![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47806] (15 PDB entries) |
![]() | Domain d3uxob1: 3uxo B:10-91 [250280] Other proteins in same PDB: d3uxoa2, d3uxoa3, d3uxob2, d3uxob3 automated match to d1tv9a1 |
PDB Entry: 3uxo (more details), 2.1 Å
SCOPe Domain Sequences for d3uxob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uxob1 a.60.6.1 (B:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki aekideflatgklrklekirqd
Timeline for d3uxob1: