Lineage for d2bosd_ (2bos D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559070Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 559367Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 559368Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 559387Domain d2bosd_: 2bos D: [25028]

Details for d2bosd_

PDB Entry: 2bos (more details), 2 Å

PDB Description: a mutant shiga-like toxin iie bound to its receptor

SCOP Domain Sequences for d2bosd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bosd_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn

SCOP Domain Coordinates for d2bosd_:

Click to download the PDB-style file with coordinates for d2bosd_.
(The format of our PDB-style files is described here.)

Timeline for d2bosd_: